Lineage for d1mcoh4 (1mco H:328-428)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655861Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 655864Species Human (Homo sapiens) [TaxId:9606] [88590] (26 PDB entries)
  8. 655903Domain d1mcoh4: 1mco H:328-428 [21471]
    Other proteins in same PDB: d1mcoh1, d1mcoh2, d1mcoh3, d1mcol1, d1mcol2
    part of intact antibody MCG
    complexed with fuc, gal, man, nag, sia

Details for d1mcoh4

PDB Entry: 1mco (more details), 3.2 Å

PDB Description: three-dimensional structure of a human immunoglobulin with a hinge deletion
PDB Compounds: (H:) igg1 mcg intact antibody (heavy chain)

SCOP Domain Sequences for d1mcoh4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcoh4 b.1.1.2 (H:328-428) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
prepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOP Domain Coordinates for d1mcoh4:

Click to download the PDB-style file with coordinates for d1mcoh4.
(The format of our PDB-style files is described here.)

Timeline for d1mcoh4: