Lineage for d1mcoh3 (1mco H:220-327)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453802Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 453803Species Human (Homo sapiens) [TaxId:9606] [88585] (22 PDB entries)
  8. 453834Domain d1mcoh3: 1mco H:220-327 [21470]
    Other proteins in same PDB: d1mcoh1, d1mcoh2, d1mcoh4, d1mcol1, d1mcol2
    part of intact antibody MCG

Details for d1mcoh3

PDB Entry: 1mco (more details), 3.2 Å

PDB Description: three-dimensional structure of a human immunoglobulin with a hinge deletion
PDB Compounds: (H:)

SCOP Domain Sequences for d1mcoh3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcoh3 b.1.1.2 (H:220-327) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)}
lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreq
qynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgq

SCOP Domain Coordinates for d1mcoh3:

Click to download the PDB-style file with coordinates for d1mcoh3.
(The format of our PDB-style files is described here.)

Timeline for d1mcoh3: