SCOPe 2.08: Domain d3p8pb_: 3p8p B:

Lineage for d3p8pb_ (3p8p B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (8 families)

5. Family d.126.1.0: automated matches [191334] (1 protein)
   not a true family

6. Protein automated matches [190175] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187904] (35 PDB entries)

8. Domain d3p8pb_: 3p8p B: [214698]
   automated match to d2jajb_
   complexed with ln6

Details for d3p8pb_

PDB Entry: 3p8p, 2.5 Å

PDB Description: crystal structure of human dimethylarginine dimethylaminohydrolase-1 (ddah-1) variant c274s bound with n5-(1-iminopentyl)-l-ornithine

PDB Compounds: (B:) N(G),N(G)-dimethylarginine dimethylaminohydrolase 1

SCOPe Domain Sequences for d3p8pb_:

Sequence; same for both SEQRES and ATOM records:

>d3p8pb_ d.126.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aafgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgsklglqvvelpa
deslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlnivemkdenatld
ggdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlksfcsmagpnlia
igssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllhrtpeeypesak
vyeklkdhmlipvsmselekvdglltscsvlinkk

Timeline for d3p8pb_:

• d3p8pb_ first appeared in SCOPe 2.03
  
• d3p8pb_ appears in SCOPe 2.07