Lineage for d3p8ea_ (3p8e A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668076Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1668077Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1668203Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 1668204Protein automated matches [190175] (6 species)
    not a true protein
  7. 1668214Species Human (Homo sapiens) [TaxId:9606] [187904] (6 PDB entries)
  8. 1668223Domain d3p8ea_: 3p8e A: [214692]
    automated match to d2jajb_
    complexed with ln7

Details for d3p8ea_

PDB Entry: 3p8e (more details), 2.49 Å

PDB Description: crystal structure of human dimethylarginine dimethylaminohydrolase-1 (ddah-1) covalently bound with n5-(1-iminopentyl)-l-ornithine
PDB Compounds: (A:) N(G),N(G)-dimethylarginine dimethylaminohydrolase 1

SCOPe Domain Sequences for d3p8ea_:

Sequence, based on SEQRES records: (download)

>d3p8ea_ d.126.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgsklglqvvelpad
eslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlnivemkdenatldg
gdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlksfcsmagpnliai
gssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllhrtpeeypesakv
yeklkdhmlipvsmselekvdglltccsvlinkk

Sequence, based on observed residues (ATOM records): (download)

>d3p8ea_ d.126.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afgrathavvralpeslgqhalrsgeevdvaraerqhqlyvgvlgsklglqvvelpades
lpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlnivemkdenatldggd
vlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlksfcsmagpnliaigs
sesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllhrtpeeypesakvye
klkdhmlipvsmselekvdglltccsvlinkk

SCOPe Domain Coordinates for d3p8ea_:

Click to download the PDB-style file with coordinates for d3p8ea_.
(The format of our PDB-style files is described here.)

Timeline for d3p8ea_: