Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (21 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188319] (14 PDB entries) |
Domain d3p86b_: 3p86 B: [214691] automated match to d3ekka_ complexed with stu; mutant |
PDB Entry: 3p86 (more details), 2.5 Å
SCOPe Domain Sequences for d3p86b_:
Sequence, based on SEQRES records: (download)
>d3p86b_ d.144.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} dmdipwcdlnikekigagsfgtvhraewhgsdvavkilmeqdfhaervneflrevaimkr lrhpnivlfmgavtqppnlsivteylsrgslyrllhksgareqlderrrlsmaydvakgm nylhnrnppivhrnlkspnllvdkkytvkvcdfglsrlkastflssksaagtpewmapev lrdepsneksdvysfgvilwelatlqqpwgnlnpaqvvaavgfkckrleiprnlnpqvaa iiegcwtnepwkrpsfatimdllrplik
>d3p86b_ d.144.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} dmdipwcdlnikekigagsfgtvhraewhgsdvavkilflrevaimkrlrhpnivlfmga vtqppnlsivteylsrgslyrllhksgareqlderrrlsmaydvakgmnylhnrnppivh rnlkspnllvdkkytvkvcdfgtpewmapevlrdepsneksdvysfgvilwelatlqqpw gnlnpaqvvaavgfkckrleiprnlnpqvaaiiegcwtnepwkrpsfatimdllrplik
Timeline for d3p86b_: