SCOPe 2.05: Domain d3p86b_: 3p86 B:

Lineage for d3p86b_ (3p86 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (21 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188319] (14 PDB entries)

8. Domain d3p86b_: 3p86 B: [214691]
   automated match to d3ekka_
   complexed with stu; mutant

Details for d3p86b_

PDB Entry: 3p86, 2.5 Å

PDB Description: crystal structure of ctr1 kinase domain mutant d676n in complex with staurosporine

PDB Compounds: (B:) Serine/threonine-protein kinase CTR1

SCOPe Domain Sequences for d3p86b_:

Sequence, based on SEQRES records:

>d3p86b_ d.144.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dmdipwcdlnikekigagsfgtvhraewhgsdvavkilmeqdfhaervneflrevaimkr
lrhpnivlfmgavtqppnlsivteylsrgslyrllhksgareqlderrrlsmaydvakgm
nylhnrnppivhrnlkspnllvdkkytvkvcdfglsrlkastflssksaagtpewmapev
lrdepsneksdvysfgvilwelatlqqpwgnlnpaqvvaavgfkckrleiprnlnpqvaa
iiegcwtnepwkrpsfatimdllrplik

Sequence, based on observed residues (ATOM records):

>d3p86b_ d.144.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dmdipwcdlnikekigagsfgtvhraewhgsdvavkilflrevaimkrlrhpnivlfmga
vtqppnlsivteylsrgslyrllhksgareqlderrrlsmaydvakgmnylhnrnppivh
rnlkspnllvdkkytvkvcdfgtpewmapevlrdepsneksdvysfgvilwelatlqqpw
gnlnpaqvvaavgfkckrleiprnlnpqvaaiiegcwtnepwkrpsfatimdllrplik

Timeline for d3p86b_:

• d3p86b_ first appeared in SCOPe 2.03
  
• d3p86b_ appears in SCOPe 2.04
  
• d3p86b_ appears in SCOPe 2.06
  
• d3p86b_ appears in the current release, SCOPe 2.08