| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
| Domain d1mcoh2: 1mco H:118-219 [21469] Other proteins in same PDB: d1mcoh1, d1mcoh3, d1mcoh4, d1mcol1, d1mcol2 part of intact antibody MCG complexed with fuc, gal, man, nag, sia |
PDB Entry: 1mco (more details), 3.2 Å
SCOP Domain Sequences for d1mcoh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mcoh2 b.1.1.2 (H:118-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvapel
Timeline for d1mcoh2: