Lineage for d3p7hd_ (3p7h D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235412Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2235413Protein automated matches [190159] (16 species)
    not a true protein
  7. 2235465Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)
  8. 2235603Domain d3p7hd_: 3p7h D: [214681]
    Other proteins in same PDB: d3p7ha2, d3p7hc2
    automated match to d2ziba_
    complexed with ca, mal

Details for d3p7hd_

PDB Entry: 3p7h (more details), 2.3 Å

PDB Description: structure of the human langerin carbohydrate recognition domain in complex with maltose
PDB Compounds: (D:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3p7hd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p7hd_ d.169.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigl
tkagmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktf
lfickrpyvp

SCOPe Domain Coordinates for d3p7hd_:

Click to download the PDB-style file with coordinates for d3p7hd_.
(The format of our PDB-style files is described here.)

Timeline for d3p7hd_: