Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries) |
Domain d3p7hc1: 3p7h C:198-325 [214680] Other proteins in same PDB: d3p7ha2, d3p7hc2 automated match to d2ziba_ complexed with ca |
PDB Entry: 3p7h (more details), 2.3 Å
SCOPe Domain Sequences for d3p7hc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p7hc1 d.169.1.0 (C:198-325) automated matches {Human (Homo sapiens) [TaxId: 9606]} gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk agmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktflf ickrpyvp
Timeline for d3p7hc1:
View in 3D Domains from other chains: (mouse over for more information) d3p7ha1, d3p7ha2, d3p7hb_, d3p7hd_ |