SCOPe 2.08: Domain d3p7ha1: 3p7h A:198-328

Lineage for d3p7ha1 (3p7h A:198-328)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)

8. Domain d3p7ha1: 3p7h A:198-328 [214678]
   Other proteins in same PDB: d3p7ha2, d3p7hc2
   automated match to d2ziba_
   complexed with ca

Details for d3p7ha1

PDB Entry: 3p7h, 2.3 Å

PDB Description: structure of the human langerin carbohydrate recognition domain in complex with maltose

PDB Compounds: (A:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3p7ha1:

Sequence; same for both SEQRES and ATOM records:

>d3p7ha1 d.169.1.0 (A:198-328) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
agmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktflf
ickrpyvpsep

Timeline for d3p7ha1:

• d3p7ha1 first appeared in SCOPe 2.03, called d3p7ha_
  
• d3p7ha1 appears in SCOPe 2.07