Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Bence-Jones lambda L chain dimer CLE (human) [49115] (1 PDB entry) |
Domain d1lilb2: 1lil B:108-215 [21467] Other proteins in same PDB: d1lila1, d1lilb1 |
PDB Entry: 1lil (more details), 2.65 Å
SCOP Domain Sequences for d1lilb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lilb2 b.1.1.2 (B:108-215) Immunoglobulin (constant domains of L and H chains) {Bence-Jones lambda L chain dimer CLE (human)} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d1lilb2: