SCOP 1.55: Domain d1lilb2: 1lil B:108-215

Lineage for d1lilb2 (1lil B:108-215)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Bence-Jones lambda L chain dimer CLE (human) [49115] (1 PDB entry)

8. Domain d1lilb2: 1lil B:108-215 [21467]
   Other proteins in same PDB: d1lila1, d1lilb1

Details for d1lilb2

PDB Entry: 1lil, 2.65 Å

PDB Description: bence jones protein cle, a lambda iii immunoglobulin light-chain dimer

SCOP Domain Sequences for d1lilb2:

Sequence; same for both SEQRES and ATOM records:

>d1lilb2 b.1.1.2 (B:108-215) Immunoglobulin (constant domains of L and H chains) {Bence-Jones lambda L chain dimer CLE (human)}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

Timeline for d1lilb2:

• d1lilb2 appears in SCOP 1.57
  
• d1lilb2 appears in the current release, SCOPe 2.08