Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins) duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site |
Protein automated matches [226920] (2 species) not a true protein |
Species Aquifex aeolicus [TaxId:63363] [226049] (2 PDB entries) |
Domain d3p76a2: 3p76 A:128-268 [214669] automated match to d1xxea2 complexed with imd, p76, zn |
PDB Entry: 3p76 (more details), 1.93 Å
SCOPe Domain Sequences for d3p76a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p76a2 d.14.1.7 (A:128-268) automated matches {Aquifex aeolicus [TaxId: 63363]} epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfafdweie hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy sfrgghslnvklvkelakkqk
Timeline for d3p76a2: