Lineage for d3p76a2 (3p76 A:128-268)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2176854Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins)
    duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site
  6. 2176913Protein automated matches [226920] (2 species)
    not a true protein
  7. 2176919Species Aquifex aeolicus [TaxId:63363] [226049] (2 PDB entries)
  8. 2176923Domain d3p76a2: 3p76 A:128-268 [214669]
    automated match to d1xxea2
    complexed with imd, p76, zn

Details for d3p76a2

PDB Entry: 3p76 (more details), 1.93 Å

PDB Description: X-ray crystal structure of Aquifex aeolicus LpxC complexed SCH1379777
PDB Compounds: (A:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d3p76a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p76a2 d.14.1.7 (A:128-268) automated matches {Aquifex aeolicus [TaxId: 63363]}
epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfafdweie
hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy
sfrgghslnvklvkelakkqk

SCOPe Domain Coordinates for d3p76a2:

Click to download the PDB-style file with coordinates for d3p76a2.
(The format of our PDB-style files is described here.)

Timeline for d3p76a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p76a1