SCOPe 2.06: Domain d3p54a2: 3p54 A:300-404

Lineage for d3p54a2 (3p54 A:300-404)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Japanese encephalitis virus [TaxId:11072] [226037] (1 PDB entry)

8. Domain d3p54a2: 3p54 A:300-404 [214663]
   Other proteins in same PDB: d3p54a1
   automated match to d1urza1

Details for d3p54a2

PDB Entry: 3p54, 2.1 Å

PDB Description: Crystal Structure of the Japanese Encephalitis Virus Envelope Protein, strain SA-14-14-2.

PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d3p54a2:

Sequence; same for both SEQRES and ATOM records:

>d3p54a2 b.1.18.0 (A:300-404) automated matches {Japanese encephalitis virus [TaxId: 11072]}
tygmctekfsfaknpvdtghgtvvielsysgsdgpckipivsvaslndmtpvgrlvtvnp
fvatssanskvlvemeppfgdsyivvgrgdkqinhhwhkagstlg

Timeline for d3p54a2:

• d3p54a2 first appeared in SCOPe 2.03
  
• d3p54a2 appears in SCOPe 2.05
  
• d3p54a2 appears in SCOPe 2.07
  
• d3p54a2 appears in the current release, SCOPe 2.08