Lineage for d3p54a2 (3p54 A:300-404)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1300237Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1300238Protein automated matches [190226] (22 species)
    not a true protein
  7. 1300295Species Japanese encephalitis virus [TaxId:11072] [226037] (1 PDB entry)
  8. 1300296Domain d3p54a2: 3p54 A:300-404 [214663]
    Other proteins in same PDB: d3p54a1
    automated match to d1urza1

Details for d3p54a2

PDB Entry: 3p54 (more details), 2.1 Å

PDB Description: Crystal Structure of the Japanese Encephalitis Virus Envelope Protein, strain SA-14-14-2.
PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d3p54a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p54a2 b.1.18.0 (A:300-404) automated matches {Japanese encephalitis virus [TaxId: 11072]}
tygmctekfsfaknpvdtghgtvvielsysgsdgpckipivsvaslndmtpvgrlvtvnp
fvatssanskvlvemeppfgdsyivvgrgdkqinhhwhkagstlg

SCOPe Domain Coordinates for d3p54a2:

Click to download the PDB-style file with coordinates for d3p54a2.
(The format of our PDB-style files is described here.)

Timeline for d3p54a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p54a1