Lineage for d3p54a1 (3p54 A:1-299)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1696556Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 1696557Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 1696600Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 1696601Protein automated matches [227047] (4 species)
    not a true protein
  7. 1696610Species Japanese encephalitis virus [TaxId:11072] [226036] (1 PDB entry)
  8. 1696611Domain d3p54a1: 3p54 A:1-299 [214662]
    Other proteins in same PDB: d3p54a2
    automated match to d1urza2

Details for d3p54a1

PDB Entry: 3p54 (more details), 2.1 Å

PDB Description: Crystal Structure of the Japanese Encephalitis Virus Envelope Protein, strain SA-14-14-2.
PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d3p54a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p54a1 f.10.1.0 (A:1-299) automated matches {Japanese encephalitis virus [TaxId: 11072]}
fnclgmgnrdfiegasgatwvdlvlegdscltimandkptldvrminieasqlaevrsyc
yhasvtdistvarcpttgeahnekradssyvckqgftdrgwgngcgffgkgsidtcakfs
ctskaigrtiqpenikykvgifvhgtttsenhgnysaqvgasqaakftvtpnapsvtlkl
gdygevtldceprsglnteafyvmtvgsksflvhrewfhdlalpwtspsstawrnrellm
efegahatkqsvvalgsqegglhqalagaivveysssvmltsghlkcrlkmdklalkgt

SCOPe Domain Coordinates for d3p54a1:

Click to download the PDB-style file with coordinates for d3p54a1.
(The format of our PDB-style files is described here.)

Timeline for d3p54a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p54a2