![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
![]() | Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) ![]() |
![]() | Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
![]() | Protein automated matches [227047] (3 species) not a true protein |
![]() | Species Japanese encephalitis virus [TaxId:11072] [226036] (1 PDB entry) |
![]() | Domain d3p54a1: 3p54 A:1-299 [214662] Other proteins in same PDB: d3p54a2 automated match to d1urza2 |
PDB Entry: 3p54 (more details), 2.1 Å
SCOPe Domain Sequences for d3p54a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p54a1 f.10.1.0 (A:1-299) automated matches {Japanese encephalitis virus [TaxId: 11072]} fnclgmgnrdfiegasgatwvdlvlegdscltimandkptldvrminieasqlaevrsyc yhasvtdistvarcpttgeahnekradssyvckqgftdrgwgngcgffgkgsidtcakfs ctskaigrtiqpenikykvgifvhgtttsenhgnysaqvgasqaakftvtpnapsvtlkl gdygevtldceprsglnteafyvmtvgsksflvhrewfhdlalpwtspsstawrnrellm efegahatkqsvvalgsqegglhqalagaivveysssvmltsghlkcrlkmdklalkgt
Timeline for d3p54a1: