Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Mycobacterium avium [TaxId:1764] [226019] (1 PDB entry) |
Domain d3p4ib2: 3p4i B:188-388 [214660] automated match to d1g99a2 complexed with edo |
PDB Entry: 3p4i (more details), 2.35 Å
SCOPe Domain Sequences for d3p4ib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p4ib2 c.55.1.0 (B:188-388) automated matches {Mycobacterium avium [TaxId: 1764]} plrglkqivlhlgngcsasaiagtrpldtsmgltpleglvmgtrsgdidpsvvsylchta gmgvddvesmlnhrsgvvglsgvrdfrrlreliesgdgaaqlaysvfthrlrkyigayla vlghtdvisftagigendaavrrdavsgmeelgivlderrnlpgakgarqisaddspitv lvvptneelaiardcvrvlgg
Timeline for d3p4ib2: