SCOPe 2.07: Domain d3p4ib2: 3p4i B:188-388

Lineage for d3p4ib2 (3p4i B:188-388)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Mycobacterium avium [TaxId:1764] [226019] (1 PDB entry)

8. Domain d3p4ib2: 3p4i B:188-388 [214660]
   automated match to d1g99a2
   complexed with edo

Details for d3p4ib2

PDB Entry: 3p4i, 2.35 Å

PDB Description: crystal structure of acetate kinase from mycobacterium avium

PDB Compounds: (B:) acetate kinase

SCOPe Domain Sequences for d3p4ib2:

Sequence; same for both SEQRES and ATOM records:

>d3p4ib2 c.55.1.0 (B:188-388) automated matches {Mycobacterium avium [TaxId: 1764]}
plrglkqivlhlgngcsasaiagtrpldtsmgltpleglvmgtrsgdidpsvvsylchta
gmgvddvesmlnhrsgvvglsgvrdfrrlreliesgdgaaqlaysvfthrlrkyigayla
vlghtdvisftagigendaavrrdavsgmeelgivlderrnlpgakgarqisaddspitv
lvvptneelaiardcvrvlgg

Timeline for d3p4ib2:

• d3p4ib2 first appeared in SCOPe 2.03
  
• d3p4ib2 appears in SCOPe 2.06
  
• d3p4ib2 appears in the current release, SCOPe 2.08