Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Bence-Jones lambda L chain dimer CLE (human) [49115] (1 PDB entry) |
Domain d1lila2: 1lil A:108-215 [21466] Other proteins in same PDB: d1lila1, d1lilb1 |
PDB Entry: 1lil (more details), 2.65 Å
SCOP Domain Sequences for d1lila2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lila2 b.1.1.2 (A:108-215) Immunoglobulin (constant domains of L and H chains) {Bence-Jones lambda L chain dimer CLE (human)} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d1lila2: