SCOPe 2.03: Domain d3p4ia1: 3p4i A:8-187

Lineage for d3p4ia1 (3p4i A:8-187)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (35 species)
   not a true protein

7. Species Mycobacterium avium [TaxId:1764] [226019] (1 PDB entry)

8. Domain d3p4ia1: 3p4i A:8-187 [214657]
   automated match to d1g99a1
   complexed with edo

Details for d3p4ia1

PDB Entry: 3p4i, 2.35 Å

PDB Description: crystal structure of acetate kinase from mycobacterium avium

PDB Compounds: (A:) acetate kinase

SCOPe Domain Sequences for d3p4ia1:

Sequence, based on SEQRES records:

>d3p4ia1 c.55.1.0 (A:8-187) automated matches {Mycobacterium avium [TaxId: 1764]}
arrvlvinsgssslkfqlvdpesgvaastgiverigeesspvpdhdaalrrafdmlagdg
vdlntaglvavghrvvhggntfyrptvlddaviarlhelselaplhnppallgievarrl
lpgiahvavfdtgffhdlppaaatyaidreladrwqirrygfhgtshryvseqaaafldr

Sequence, based on observed residues (ATOM records):

>d3p4ia1 c.55.1.0 (A:8-187) automated matches {Mycobacterium avium [TaxId: 1764]}
arrvlvinsgssslkfqlvdpesgvaastgiveriesspvpdhdaalrrafdmlagdgvd
lntaglvavghrvvhggntfyrptvlddaviarlhelselaplhnppallgievarrllp
giahvavfdtgffhdlppaaatyaidreladrwqirrygfhgtshryvseqaaafldr

Timeline for d3p4ia1:

• d3p4ia1 is new in SCOPe 2.03-stable
  
• d3p4ia1 appears in SCOPe 2.04
  
• d3p4ia1 appears in the current release, SCOPe 2.08