Lineage for d3p3za_ (3p3z A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278276Species Streptomyces thioluteus [TaxId:66431] [226078] (4 PDB entries)
  8. 1278280Domain d3p3za_: 3p3z A: [214653]
    automated match to d2nzaa_
    complexed with cl, gol, hem, p3z

Details for d3p3za_

PDB Entry: 3p3z (more details), 2.3 Å

PDB Description: crystal structure of the cytochrome p450 monooxygenase aurh from streptomyces thioluteus in complex with ancymidol
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d3p3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p3za_ a.104.1.0 (A:) automated matches {Streptomyces thioluteus [TaxId: 66431]}
nmsttahtepswadlpfldftdpnfswdspevaearekswiartplallvlryaeadqla
rdkrlisgfrglvdmvgtpegpvrdfmvdflqsldgadhrrlrglathpftprritavqp
fvrstveqlidklpqgdfdfvqhfphplpalvmcqllgfpledydtvgrlsietnlglal
sndqdilvkveqglgrmfdylvaaiekrkvepgddltsdivrafhdgvlddyelrtlvat
vlvagyettnhqlalamydfaqhpdqwmkikenpelapqaveevlrwsptlpvtatrvaa
edfevngvriptgtpvfmcahvahrdprvfadadrfditvkreapsiafgggphfclgta
larlelteavaalatrldppqiageitwrhelgvagpdalplrfgaa

SCOPe Domain Coordinates for d3p3za_:

Click to download the PDB-style file with coordinates for d3p3za_.
(The format of our PDB-style files is described here.)

Timeline for d3p3za_: