Lineage for d3p3za1 (3p3z A:1-406)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005926Species Streptomyces thioluteus [TaxId:66431] [226078] (4 PDB entries)
  8. 2005930Domain d3p3za1: 3p3z A:1-406 [214653]
    Other proteins in same PDB: d3p3za2
    automated match to d2nzaa_
    complexed with cl, gol, hem, p3z

Details for d3p3za1

PDB Entry: 3p3z (more details), 2.3 Å

PDB Description: crystal structure of the cytochrome p450 monooxygenase aurh from streptomyces thioluteus in complex with ancymidol
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d3p3za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p3za1 a.104.1.0 (A:1-406) automated matches {Streptomyces thioluteus [TaxId: 66431]}
msttahtepswadlpfldftdpnfswdspevaearekswiartplallvlryaeadqlar
dkrlisgfrglvdmvgtpegpvrdfmvdflqsldgadhrrlrglathpftprritavqpf
vrstveqlidklpqgdfdfvqhfphplpalvmcqllgfpledydtvgrlsietnlglals
ndqdilvkveqglgrmfdylvaaiekrkvepgddltsdivrafhdgvlddyelrtlvatv
lvagyettnhqlalamydfaqhpdqwmkikenpelapqaveevlrwsptlpvtatrvaae
dfevngvriptgtpvfmcahvahrdprvfadadrfditvkreapsiafgggphfclgtal
arlelteavaalatrldppqiageitwrhelgvagpdalplrfgaa

SCOPe Domain Coordinates for d3p3za1:

Click to download the PDB-style file with coordinates for d3p3za1.
(The format of our PDB-style files is described here.)

Timeline for d3p3za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p3za2