![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces thioluteus [TaxId:66431] [226078] (4 PDB entries) |
![]() | Domain d3p3xb_: 3p3x B: [214652] automated match to d2nzaa_ complexed with cl, gol, hem, so4 |
PDB Entry: 3p3x (more details), 2.3 Å
SCOPe Domain Sequences for d3p3xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p3xb_ a.104.1.0 (B:) automated matches {Streptomyces thioluteus [TaxId: 66431]} htepswadlpfldftdpnfswdspevaearekswiartplallvlryaeadqlardkrli sgfrglvdmvgtpegpvrdfmvdflqsldgadhrrlrglathpftprritavqpfvrstv eqlidklpqgdfdfvqhfphplpalvmcqllgfpledydtvgrlsietnlglalsndqdi lvkveqglgrmfdylvaaiekrkvepgddltsdivrafhdgvlddyelrtlvatvlvagy ettnhqlalamydfaqhpdqwmkikenpelapqaveevlrwsptlpvtatrvaaedfevn gvriptgtpvfmcahvahrdprvfadadrfditvkreapsiafgggphfclgtalarlel teavaalatrldppqiageitwrhelgvagpdalplrfg
Timeline for d3p3xb_: