Lineage for d3p3lb_ (3p3l B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2332221Species Streptomyces thioluteus [TaxId:66431] [226078] (4 PDB entries)
  8. 2332224Domain d3p3lb_: 3p3l B: [214641]
    automated match to d2dkka_
    complexed with cl, epe, hem, so4

Details for d3p3lb_

PDB Entry: 3p3l (more details), 2.1 Å

PDB Description: crystal structure of the cytochrome p450 monooxygenase aurh (wildtype) from streptomyces thioluteus
PDB Compounds: (B:) cytochrome p450

SCOPe Domain Sequences for d3p3lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p3lb_ a.104.1.0 (B:) automated matches {Streptomyces thioluteus [TaxId: 66431]}
tahtepswadlpfldftdpnfswdspevaearekswiartplallvlryaeadqlardkr
lisgfrglvdmvgtpegpvrdfmvdflqsldgadhrrlrglathpftprritavqpfvrs
tveqlidklpqgdfdfvqhfahplpalvmcqllgfpledydtvgrlsietnlglalsndq
dilvkveqglgrmfdylvaaiekrkvepgddltsdivrafhdgvlddyelrtlvatvlva
gyettnhqlalamydfaqhpdqwmkikenpelapqaveevlrwsptlpvtatrvaaedfe
vngvriptgtpvfmcahvahrdprvfadadrfditvkreapsiafgggphfclgtalarl
elteavaalatrldppqiageitwrhelgvagpdalplrfgaa

SCOPe Domain Coordinates for d3p3lb_:

Click to download the PDB-style file with coordinates for d3p3lb_.
(The format of our PDB-style files is described here.)

Timeline for d3p3lb_: