SCOP 1.57: Domain d4bjla2: 4bjl A:112-216

Lineage for d4bjla2 (4bjl A:112-216)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Bence-Jones lambda L chain dimer LOC (human) [49114] (3 PDB entries)

8. Domain d4bjla2: 4bjl A:112-216 [21464]
   Other proteins in same PDB: d4bjla1, d4bjlb1

Details for d4bjla2

PDB Entry: 4bjl, 2.4 Å

PDB Description: locw, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in distilled water

SCOP Domain Sequences for d4bjla2:

Sequence; same for both SEQRES and ATOM records:

>d4bjla2 b.1.1.2 (A:112-216) Immunoglobulin (constant domains of L and H chains) {Bence-Jones lambda L chain dimer LOC (human)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

Timeline for d4bjla2:

• d4bjla2 first appeared (with stable ids) in SCOP 1.55
  
• d4bjla2 appears in SCOP 1.59
  
• d4bjla2 appears in the current release, SCOPe 2.08