Lineage for d4bjla2 (4bjl A:112-216)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8579Species Bence-Jones lambda L chain dimer LOC (human) [49114] (3 PDB entries)
  8. 8584Domain d4bjla2: 4bjl A:112-216 [21464]
    Other proteins in same PDB: d4bjla1, d4bjlb1

Details for d4bjla2

PDB Entry: 4bjl (more details), 2.4 Å

PDB Description: locw, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in distilled water

SCOP Domain Sequences for d4bjla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bjla2 b.1.1.2 (A:112-216) Immunoglobulin (constant domains of L and H chains) {Bence-Jones lambda L chain dimer LOC (human)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOP Domain Coordinates for d4bjla2:

Click to download the PDB-style file with coordinates for d4bjla2.
(The format of our PDB-style files is described here.)

Timeline for d4bjla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bjla1