![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
![]() | Species Bence-Jones lambda L chain dimer LOC (human) [49114] (3 PDB entries) |
![]() | Domain d4bjla2: 4bjl A:112-216 [21464] Other proteins in same PDB: d4bjla1, d4bjlb1 |
PDB Entry: 4bjl (more details), 2.4 Å
SCOP Domain Sequences for d4bjla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bjla2 b.1.1.2 (A:112-216) Immunoglobulin (constant domains of L and H chains) {Bence-Jones lambda L chain dimer LOC (human)} qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d4bjla2: