Lineage for d3p32a_ (3p32 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114511Species Mycobacterium tuberculosis [TaxId:1773] [189039] (15 PDB entries)
  8. 2114516Domain d3p32a_: 3p32 A: [214637]
    automated match to d2wwwb_
    complexed with gdp, pge

Details for d3p32a_

PDB Entry: 3p32 (more details), 1.9 Å

PDB Description: hydrolysis of gtp to gdp by an mcm-associated and meab- and mmaa-like g-protein from mycobacterium tuberculosis
PDB Compounds: (A:) Probable GTPase Rv1496/MT1543

SCOPe Domain Sequences for d3p32a_:

Sequence, based on SEQRES records: (download)

>d3p32a_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tvdglatavrggdraalpraitlvestrpdhreqaqqlllrllpdsgnahrvgitgvpgv
gkstaiealgmhlierghrvavlavdpsstrtggsilgdktrmarlavhpnayirpspts
gtlggvtratretvvlleaagfdvilietvgvgqsevavanmvdtfvlltlartgdqlqg
ikkgvleladivvvnkadgehhkearlaarelsaairliyprealwrppvltmsavegrg
laelwdtverhrqvltgagefdarrrdqqvdwtwqlvrdavldrvwsnptvrkvrseler
rvrageltpalaaqqileianltd

Sequence, based on observed residues (ATOM records): (download)

>d3p32a_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tvdglatavrggdraalpraitlvestrpdhreqaqqlllrllpdsgnahrvgitgvpgv
gkstaiealgmhlierghrvavlavdmarlavhpnayirpspgtlggvtratretvvlle
aagfdvilietvgvgqsevavanmvdtfvlltlartgdqlqgikkgvleladivvvnkad
gehhkearlaarelsaairliyprealwrppvltmsavegrglaelwdtverhrqvltga
gefdarrrdqqvdwtwqlvrdavldrvwsnptvrkvrselerrvrageltpalaaqqile
ianltd

SCOPe Domain Coordinates for d3p32a_:

Click to download the PDB-style file with coordinates for d3p32a_.
(The format of our PDB-style files is described here.)

Timeline for d3p32a_: