SCOPe 2.08: Domain d3p2ta2: 3p2t A:97-195

Lineage for d3p2ta2 (3p2t A:97-195)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3p2ta2: 3p2t A:97-195 [214634]
   automated match to d1ovzb2
   complexed with so4

Details for d3p2ta2

PDB Entry: 3p2t, 1.7 Å

PDB Description: crystal structure of leukocyte ig-like receptor lilrb4 (ilt3/lir-5/cd85k)

PDB Compounds: (A:) Leukocyte immunoglobulin-like receptor subfamily B member 4

SCOPe Domain Sequences for d3p2ta2:

Sequence; same for both SEQRES and ATOM records:

>d3p2ta2 b.1.1.0 (A:97-195) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayskptlsalpsplvtsgksvtllcqsrspmdtfllckeraahpllclrsehgaqqhqae
fpmspvtsvhggtyrcfsshgfshyllshpsdplelivs

Timeline for d3p2ta2:

• d3p2ta2 first appeared in SCOPe 2.03
  
• d3p2ta2 appears in SCOPe 2.07