Lineage for d3p2ta1 (3p2t A:2-96)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519281Domain d3p2ta1: 3p2t A:2-96 [214633]
    automated match to d1ovzb1
    complexed with so4

Details for d3p2ta1

PDB Entry: 3p2t (more details), 1.7 Å

PDB Description: crystal structure of leukocyte ig-like receptor lilrb4 (ilt3/lir-5/cd85k)
PDB Compounds: (A:) Leukocyte immunoglobulin-like receptor subfamily B member 4

SCOPe Domain Sequences for d3p2ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p2ta1 b.1.1.0 (A:2-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plpkptlwaepgsviswgnsvtiwcqgtleareyrldkeespapwdrqnplepknkarfs
ipsmtedyagryrcyyrspvgwsqpsdplelvmtg

SCOPe Domain Coordinates for d3p2ta1:

Click to download the PDB-style file with coordinates for d3p2ta1.
(The format of our PDB-style files is described here.)

Timeline for d3p2ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p2ta2