SCOPe 2.08: Domain d3p2ob2: 3p2o B:120-281

Lineage for d3p2ob2 (3p2o B:120-281)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [225997] (8 PDB entries)

8. Domain d3p2ob2: 3p2o B:120-281 [214632]
   Other proteins in same PDB: d3p2oa1, d3p2oa3, d3p2ob1, d3p2ob3
   automated match to d1b0aa1
   complexed with gol, nad

Details for d3p2ob2

PDB Entry: 3p2o, 2.23 Å

PDB Description: Crystal Structure of FolD Bifunctional Protein from Campylobacter jejuni

PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d3p2ob2:

Sequence; same for both SEQRES and ATOM records:

>d3p2ob2 c.2.1.0 (B:120-281) automated matches {Campylobacter jejuni [TaxId: 192222]}
fhpinvgylnlglesgflpctplgvmkllkayeidlegkdaviigasnivgrpmatmlln
agatvsvchiktkdlslytrqadliivaagcvnllrsdmvkegvivvdvginrlesgkiv
gdvdfeevskkssyitpvpggvgpmtiamllentvksaknrl

Timeline for d3p2ob2:

• d3p2ob2 first appeared in SCOPe 2.03
  
• d3p2ob2 appears in SCOPe 2.07