Lineage for d3p2ob2 (3p2o B:120-281)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846457Species Campylobacter jejuni [TaxId:192222] [225997] (8 PDB entries)
  8. 2846467Domain d3p2ob2: 3p2o B:120-281 [214632]
    Other proteins in same PDB: d3p2oa1, d3p2oa3, d3p2ob1, d3p2ob3
    automated match to d1b0aa1
    complexed with gol, nad

Details for d3p2ob2

PDB Entry: 3p2o (more details), 2.23 Å

PDB Description: Crystal Structure of FolD Bifunctional Protein from Campylobacter jejuni
PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d3p2ob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p2ob2 c.2.1.0 (B:120-281) automated matches {Campylobacter jejuni [TaxId: 192222]}
fhpinvgylnlglesgflpctplgvmkllkayeidlegkdaviigasnivgrpmatmlln
agatvsvchiktkdlslytrqadliivaagcvnllrsdmvkegvivvdvginrlesgkiv
gdvdfeevskkssyitpvpggvgpmtiamllentvksaknrl

SCOPe Domain Coordinates for d3p2ob2:

Click to download the PDB-style file with coordinates for d3p2ob2.
(The format of our PDB-style files is described here.)

Timeline for d3p2ob2: