SCOPe 2.07: Domain d3p2ob1: 3p2o B:1-119

Lineage for d3p2ob1 (3p2o B:1-119)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (38 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [225996] (3 PDB entries)

8. Domain d3p2ob1: 3p2o B:1-119 [214631]
   Other proteins in same PDB: d3p2oa2, d3p2oa3, d3p2ob2, d3p2ob3
   automated match to d1b0aa2
   complexed with gol, nad

Details for d3p2ob1

PDB Entry: 3p2o, 2.23 Å

PDB Description: Crystal Structure of FolD Bifunctional Protein from Campylobacter jejuni

PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d3p2ob1:

Sequence; same for both SEQRES and ATOM records:

>d3p2ob1 c.58.1.0 (B:1-119) automated matches {Campylobacter jejuni [TaxId: 192222]}
mtlldgkalsakikeelkeknqflkskgiesclavilvgdnpasqtyvkskakaceecgi
kslvyhlnenitqnellalintlnhddsvhgilvqlplpdhickdlilesiisskdvdg

Timeline for d3p2ob1:

• d3p2ob1 first appeared in SCOPe 2.03
  
• d3p2ob1 appears in SCOPe 2.06
  
• d3p2ob1 appears in the current release, SCOPe 2.08