Lineage for d3p2ob1 (3p2o B:0-119)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1376891Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1376892Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1377194Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 1377195Protein automated matches [226864] (18 species)
    not a true protein
  7. 1377216Species Campylobacter jejuni [TaxId:192222] [225996] (1 PDB entry)
  8. 1377218Domain d3p2ob1: 3p2o B:0-119 [214631]
    Other proteins in same PDB: d3p2oa2, d3p2ob2
    automated match to d1b0aa2
    complexed with gol, nad

Details for d3p2ob1

PDB Entry: 3p2o (more details), 2.23 Å

PDB Description: Crystal Structure of FolD Bifunctional Protein from Campylobacter jejuni
PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d3p2ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p2ob1 c.58.1.0 (B:0-119) automated matches {Campylobacter jejuni [TaxId: 192222]}
amtlldgkalsakikeelkeknqflkskgiesclavilvgdnpasqtyvkskakaceecg
ikslvyhlnenitqnellalintlnhddsvhgilvqlplpdhickdlilesiisskdvdg

SCOPe Domain Coordinates for d3p2ob1:

Click to download the PDB-style file with coordinates for d3p2ob1.
(The format of our PDB-style files is described here.)

Timeline for d3p2ob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p2ob2