SCOP 1.59: Domain d3bjlb2: 3bjl B:112-216

Lineage for d3bjlb2 (3bjl B:112-216)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Bence-Jones lambda L chain dimer LOC (human) [49114] (3 PDB entries)

8. Domain d3bjlb2: 3bjl B:112-216 [21463]
   Other proteins in same PDB: d3bjla1, d3bjlb1

Details for d3bjlb2

PDB Entry: 3bjl, 2.3 Å

PDB Description: loc, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in ammonium sulfate

SCOP Domain Sequences for d3bjlb2:

Sequence; same for both SEQRES and ATOM records:

>d3bjlb2 b.1.1.2 (B:112-216) Immunoglobulin (constant domains of L and H chains) {Bence-Jones lambda L chain dimer LOC (human)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

Timeline for d3bjlb2:

• d3bjlb2 first appeared (with stable ids) in SCOP 1.55
  
• d3bjlb2 appears in SCOP 1.57
  
• d3bjlb2 appears in SCOP 1.61
  
• d3bjlb2 appears in the current release, SCOPe 2.08