Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (40 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [225996] (3 PDB entries) |
Domain d3p2oa1: 3p2o A:1-119 [214629] Other proteins in same PDB: d3p2oa2, d3p2oa3, d3p2ob2, d3p2ob3 automated match to d1b0aa2 complexed with gol, nad |
PDB Entry: 3p2o (more details), 2.23 Å
SCOPe Domain Sequences for d3p2oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p2oa1 c.58.1.0 (A:1-119) automated matches {Campylobacter jejuni [TaxId: 192222]} mtlldgkalsakikeelkeknqflkskgiesclavilvgdnpasqtyvkskakaceecgi kslvyhlnenitqnellalintlnhddsvhgilvqlplpdhickdlilesiisskdvdg
Timeline for d3p2oa1: