Lineage for d3p2ja_ (3p2j A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889282Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2889299Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2889300Protein automated matches [193326] (11 species)
    not a true protein
  7. 2889338Species Mycobacterium smegmatis [TaxId:246196] [225939] (5 PDB entries)
  8. 2889339Domain d3p2ja_: 3p2j A: [214628]
    automated match to d4jy7a_

Details for d3p2ja_

PDB Entry: 3p2j (more details), 2.22 Å

PDB Description: Crystal structure of peptidyl-tRNA hydrolase from Mycobacterium smegmatis at 2.2 A resolution
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d3p2ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p2ja_ c.56.3.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
maepllvvglgnpgptyaktrhnlgfmvadvlagrigsafkvhkksgaevvtgrlagttv
vlakprismnesgrqvgplakfysvppqqivvihdeldidfgrirlklgggegghnglrs
vasalgtknfhrvrigvgrppgrkdpaafvlenftsaeraevptiveqaadatelliaqg
lepaqntvhaw

SCOPe Domain Coordinates for d3p2ja_:

Click to download the PDB-style file with coordinates for d3p2ja_.
(The format of our PDB-style files is described here.)

Timeline for d3p2ja_: