Lineage for d3p1ic_ (3p1i C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774192Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
    automatically mapped to Pfam PF01404
  6. 2774206Protein automated matches [190969] (1 species)
    not a true protein
  7. 2774207Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries)
  8. 2774210Domain d3p1ic_: 3p1i C: [214623]
    Other proteins in same PDB: d3p1ia2
    automated match to d2wo1a_
    complexed with cl, so4

Details for d3p1ic_

PDB Entry: 3p1i (more details), 2.1 Å

PDB Description: Ligand binding domain of human ephrin type-B receptor 3
PDB Compounds: (C:) Ephrin type-B receptor 3

SCOPe Domain Sequences for d3p1ic_:

Sequence, based on SEQRES records: (download)

>d3p1ic_ b.18.1.4 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eetlmdtkwvtselawtshpesgweevsgydeamnpirtyqvcnvressqnnwlrtgfiw
rrdvqrvyvelkftvrdcnsipnipgscketfnlfyyeadsdvasasspfwmenpyvkvd
tiapdesfsrldagrvntkvrsfgplskagfylafqdqgacmslisvrafyk

Sequence, based on observed residues (ATOM records): (download)

>d3p1ic_ b.18.1.4 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eetlmdtkwvtselawtshpesgweevsgydeamnpirtyqvcnvressqnnwlrtgfiw
rrdvqrvyvelkftvrdcnsipnipgscketfnlfyyeadsdvasasspfwmenpyvkvd
tiapdesfgrvntkvrsfgplskagfylafqdqgacmslisvrafyk

SCOPe Domain Coordinates for d3p1ic_:

Click to download the PDB-style file with coordinates for d3p1ic_.
(The format of our PDB-style files is described here.)

Timeline for d3p1ic_: