SCOPe 2.04: Domain d3p1ia_: 3p1i A:

Lineage for d3p1ia_ (3p1i A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
   automatically mapped to Pfam PF01404

6. Protein automated matches [190969] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries)

8. Domain d3p1ia_: 3p1i A: [214621]
   automated match to d2wo1a_
   complexed with cl, so4

Details for d3p1ia_

PDB Entry: 3p1i, 2.1 Å

PDB Description: Ligand binding domain of human ephrin type-B receptor 3

PDB Compounds: (A:) Ephrin type-B receptor 3

SCOPe Domain Sequences for d3p1ia_:

Sequence, based on SEQRES records:

>d3p1ia_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deetlmdtkwvtselawtshpesgweevsgydeamnpirtyqvcnvressqnnwlrtgfi
wrrdvqrvyvelkftvrdcnsipnipgscketfnlfyyeadsdvasasspfwmenpyvkv
dtiapdesfsrldagrvntkvrsfgplskagfylafqdqgacmslisvrafykk

Sequence, based on observed residues (ATOM records):

>d3p1ia_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deetlmdtkwvtselawtshpesgweevsgydeamnpirtyqvcnvressqnnwlrtgfi
wrrdvqrvyvelkftvrdcnsipnipgscketfnlfyyeadsdvasasspfwmenpyvkv
dtiapdesfsagrvntkvrsfgplskagfylafqdqgacmslisvrafykk

Timeline for d3p1ia_:

• d3p1ia_ first appeared in SCOPe 2.03
  
• d3p1ia_ appears in SCOPe 2.05
  
• d3p1ia_ appears in the current release, SCOPe 2.08, called d3p1ia1