SCOPe 2.06: Domain d3p0tb1: 3p0t B:1-134

Lineage for d3p0tb1 (3p0t B:1-134)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (5 families)

5. Family d.13.1.0: automated matches [191614] (1 protein)
   not a true family

6. Protein automated matches [191122] (9 species)
   not a true protein

7. Species Mycobacterium avium [TaxId:262316] [226035] (1 PDB entry)

8. Domain d3p0tb1: 3p0t B:1-134 [214613]
   Other proteins in same PDB: d3p0ta2, d3p0tb2
   automated match to d3oxka_
   complexed with edo, so4

Details for d3p0tb1

PDB Entry: 3p0t, 1.9 Å

PDB Description: crystal structure of an hit-like protein from mycobacterium paratuberculosis

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d3p0tb1:

Sequence; same for both SEQRES and ATOM records:

>d3p0tb1 d.13.1.0 (B:1-134) automated matches {Mycobacterium avium [TaxId: 262316]}
masiftkiinrelpgrfvyedddvvafltiepmtqghtlvvpreeidnwqdvdsaafnrv
mgvsqligkavckafrtersgliiaglevphlhvhvfptrslsdfgfanvdrnpspesld
eaqakikaalaqla

Timeline for d3p0tb1:

• d3p0tb1 first appeared in SCOPe 2.03, called d3p0tb_
  
• d3p0tb1 was called d3p0tb_ in SCOPe 2.05
  
• d3p0tb1 appears in SCOPe 2.07
  
• d3p0tb1 appears in the current release, SCOPe 2.08