Lineage for d3p0ta1 (3p0t A:1-134)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929994Family d.13.1.0: automated matches [191614] (1 protein)
    not a true family
  6. 2929995Protein automated matches [191122] (10 species)
    not a true protein
  7. 2930034Species Mycobacterium avium [TaxId:262316] [226035] (1 PDB entry)
  8. 2930035Domain d3p0ta1: 3p0t A:1-134 [214612]
    Other proteins in same PDB: d3p0ta2, d3p0tb2
    automated match to d3oxka_
    complexed with edo, so4

Details for d3p0ta1

PDB Entry: 3p0t (more details), 1.9 Å

PDB Description: crystal structure of an hit-like protein from mycobacterium paratuberculosis
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d3p0ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p0ta1 d.13.1.0 (A:1-134) automated matches {Mycobacterium avium [TaxId: 262316]}
masiftkiinrelpgrfvyedddvvafltiepmtqghtlvvpreeidnwqdvdsaafnrv
mgvsqligkavckafrtersgliiaglevphlhvhvfptrslsdfgfanvdrnpspesld
eaqakikaalaqla

SCOPe Domain Coordinates for d3p0ta1:

Click to download the PDB-style file with coordinates for d3p0ta1.
(The format of our PDB-style files is described here.)

Timeline for d3p0ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p0ta2