| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
| Family d.13.1.0: automated matches [191614] (1 protein) not a true family |
| Protein automated matches [191122] (10 species) not a true protein |
| Species Mycobacterium avium [TaxId:262316] [226035] (1 PDB entry) |
| Domain d3p0ta1: 3p0t A:1-134 [214612] Other proteins in same PDB: d3p0ta2, d3p0tb2 automated match to d3oxka_ complexed with edo, so4 |
PDB Entry: 3p0t (more details), 1.9 Å
SCOPe Domain Sequences for d3p0ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p0ta1 d.13.1.0 (A:1-134) automated matches {Mycobacterium avium [TaxId: 262316]}
masiftkiinrelpgrfvyedddvvafltiepmtqghtlvvpreeidnwqdvdsaafnrv
mgvsqligkavckafrtersgliiaglevphlhvhvfptrslsdfgfanvdrnpspesld
eaqakikaalaqla
Timeline for d3p0ta1: