Lineage for d3ozgb_ (3ozg B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2892086Species Plasmodium falciparum [TaxId:5838] [226804] (2 PDB entries)
  8. 2892092Domain d3ozgb_: 3ozg B: [214606]
    automated match to d1qk3c_
    complexed with mg, pop, ssi

Details for d3ozgb_

PDB Entry: 3ozg (more details), 1.99 Å

PDB Description: crystal structure of plasmodium falciparum hypoxanthine-guanine- xanthine phosphoribosyltransferase in complex with s-serme-immh phosphonate
PDB Compounds: (B:) hypoxanthine-guanine-xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d3ozgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ozgb_ c.61.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 5838]}
mpipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklayd
ikkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndq
stgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtpl
wngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkyka

SCOPe Domain Coordinates for d3ozgb_:

Click to download the PDB-style file with coordinates for d3ozgb_.
(The format of our PDB-style files is described here.)

Timeline for d3ozgb_: