| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
| Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
| Protein automated matches [190891] (18 species) not a true protein |
| Species Plasmodium falciparum [TaxId:5838] [226804] (2 PDB entries) |
| Domain d3ozga_: 3ozg A: [214605] automated match to d1qk3c_ complexed with mg, pop, ssi |
PDB Entry: 3ozg (more details), 1.99 Å
SCOPe Domain Sequences for d3ozga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ozga_ c.61.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 5838]}
pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi
kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs
tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw
ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkyka
Timeline for d3ozga_: