SCOPe 2.06: Domain d3ozfc_: 3ozf C:

Lineage for d3ozfc_ (3ozf C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (32 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:5838] [226804] (2 PDB entries)

8. Domain d3ozfc_: 3ozf C: [214603]
   Other proteins in same PDB: d3ozfa2, d3ozfb2
   automated match to d1qk3c_
   complexed with hpa, mg, po4, pop

Details for d3ozfc_

PDB Entry: 3ozf, 1.94 Å

PDB Description: crystal structure of plasmodium falciparum hypoxanthine-guanine- xanthine phosphoribosyltransferase in complex with hypoxanthine

PDB Compounds: (C:) hypoxanthine-guanine-xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d3ozfc_:

Sequence; same for both SEQRES and ATOM records:

>d3ozfc_ c.61.1.0 (C:) automated matches {Plasmodium falciparum [TaxId: 5838]}
pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi
kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs
tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw
ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykat

Timeline for d3ozfc_:

• d3ozfc_ first appeared in SCOPe 2.03
  
• d3ozfc_ appears in SCOPe 2.05
  
• d3ozfc_ appears in SCOPe 2.07
  
• d3ozfc_ appears in the current release, SCOPe 2.08