SCOPe 2.08: Domain d3oz9l2: 3oz9 L:111-213

Lineage for d3oz9l2 (3oz9 L:111-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3oz9l2: 3oz9 L:111-213 [214600]
   Other proteins in same PDB: d3oz9h1, d3oz9h2, d3oz9l1
   automated match to d2fbjl2
   complexed with gol

Details for d3oz9l2

PDB Entry: 3oz9, 1.6 Å

PDB Description: crystal structure of anti-gp41 fab nc-1

PDB Compounds: (L:) Fab NC-1 kappa light chain

SCOPe Domain Sequences for d3oz9l2:

Sequence; same for both SEQRES and ATOM records:

>d3oz9l2 b.1.1.2 (L:111-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d3oz9l2:

• d3oz9l2 first appeared in SCOPe 2.03
  
• d3oz9l2 appears in SCOPe 2.07