Lineage for d1bjma2 (1bjm A:112-216)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159429Species Bence-Jones lambda L chain dimer LOC (human) [49114] (3 PDB entries)
  8. 159430Domain d1bjma2: 1bjm A:112-216 [21460]
    Other proteins in same PDB: d1bjma1, d1bjmb1

Details for d1bjma2

PDB Entry: 1bjm (more details), 2.2 Å

PDB Description: loc naks, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in nakso4

SCOP Domain Sequences for d1bjma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjma2 b.1.1.2 (A:112-216) Immunoglobulin (constant domains of L and H chains) {Bence-Jones lambda L chain dimer LOC (human)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOP Domain Coordinates for d1bjma2:

Click to download the PDB-style file with coordinates for d1bjma2.
(The format of our PDB-style files is described here.)

Timeline for d1bjma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bjma1