SCOPe 2.04: Domain d3oytb2: 3oyt B:253-406

Lineage for d3oytb2 (3oyt B:253-406)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (45 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [226052] (2 PDB entries)

8. Domain d3oytb2: 3oyt B:253-406 [214598]
   automated match to d1ox0a2
   complexed with edo, k, peg, pg4, pge, po4

Details for d3oytb2

PDB Entry: 3oyt, 1.84 Å

PDB Description: 1.84 angstrom resolution crystal structure of 3-oxoacyl-(acyl carrier protein) synthase i (fabb) from yersinia pestis co92

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d3oytb2:

Sequence, based on SEQRES records:

>d3oytb2 c.95.1.0 (B:253-406) automated matches {Yersinia pestis [TaxId: 632]}
hiyaeivgygatsdgadmvapsgegavrcmqmamagvdtpidymnvhgtstpvgdvkelg
airevfgnntpaisstkamtghslgaagvheaifsllmvehgfiapsinidnldeqaqgm
niitettqrelttvmsnsfgfggtnatlvmrkyq

Sequence, based on observed residues (ATOM records):

>d3oytb2 c.95.1.0 (B:253-406) automated matches {Yersinia pestis [TaxId: 632]}
hiyaeivgygatsdgegavrcmqmamagvdtpidymnvhgtstpvgdvkelgairevfgn
ntpaisstkamtghslgaagvheaifsllmvehgfiapsinidnldeqaqgmniitettq
relttvmsnsfgfggtnatlvmrkyq

Timeline for d3oytb2:

• d3oytb2 first appeared in SCOPe 2.03
  
• d3oytb2 appears in SCOPe 2.05
  
• d3oytb2 appears in the current release, SCOPe 2.08