Lineage for d3oytb1 (3oyt B:1-252)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1627417Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1627418Protein automated matches [196909] (45 species)
    not a true protein
  7. 1627940Species Yersinia pestis [TaxId:632] [226052] (2 PDB entries)
  8. 1627943Domain d3oytb1: 3oyt B:1-252 [214597]
    automated match to d1ox0a1
    complexed with edo, k, peg, pg4, pge, po4

Details for d3oytb1

PDB Entry: 3oyt (more details), 1.84 Å

PDB Description: 1.84 angstrom resolution crystal structure of 3-oxoacyl-(acyl carrier protein) synthase i (fabb) from yersinia pestis co92
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d3oytb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oytb1 c.95.1.0 (B:1-252) automated matches {Yersinia pestis [TaxId: 632]}
mkravitglgivssignnqqevlaslqegrsgitfaqefkdagmrshvwgdvklqsepkd
lidrkvlrfmsdasiyaylamqeaiadsglsdsqvsnfrsglvvgsgggsprnqvagsda
mrtprglkgvgpymvtkamasgvsaclatpfkikgvnysissacatsahcighaleliql
gkqdivfagggeelcwemacefdamgalstkyndtpakasrtydqdrdgfviaggggmvv
veelehalarga

SCOPe Domain Coordinates for d3oytb1:

Click to download the PDB-style file with coordinates for d3oytb1.
(The format of our PDB-style files is described here.)

Timeline for d3oytb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3oytb2