Lineage for d1ehlh2 (1ehl H:114-227)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8544Species Anti-photoproduct Fab 64M-2, (mouse), kappa L chain [49113] (1 PDB entry)
  8. 8545Domain d1ehlh2: 1ehl H:114-227 [21459]
    Other proteins in same PDB: d1ehlh1, d1ehll1

Details for d1ehlh2

PDB Entry: 1ehl (more details), 2.4 Å

PDB Description: 64m-2 antibody fab complexed with d(5ht)(6-4)t

SCOP Domain Sequences for d1ehlh2:

Sequence, based on SEQRES records: (download)

>d1ehlh2 b.1.1.2 (H:114-227) Immunoglobulin (constant domains of L and H chains) {Anti-photoproduct Fab 64M-2, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

Sequence, based on observed residues (ATOM records): (download)

>d1ehlh2 b.1.1.2 (H:114-227) Immunoglobulin (constant domains of L and H chains) {Anti-photoproduct Fab 64M-2, (mouse), kappa L chain}
akttapsvyplapvcgdgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
tlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

SCOP Domain Coordinates for d1ehlh2:

Click to download the PDB-style file with coordinates for d1ehlh2.
(The format of our PDB-style files is described here.)

Timeline for d1ehlh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ehlh1