Lineage for d3oxof1 (3oxo F:1-246)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922354Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 proteins)
    parallel beta-sheet of 7 strands, order 4321567
  6. 2922422Protein automated matches [227045] (1 species)
    not a true protein
  7. 2922423Species Pig (Sus scrofa) [TaxId:9823] [226016] (1 PDB entry)
  8. 2922429Domain d3oxof1: 3oxo F:1-246 [214589]
    Other proteins in same PDB: d3oxoa2, d3oxoa3, d3oxob2, d3oxob3, d3oxoc2, d3oxoc3, d3oxod2, d3oxod3, d3oxoe2, d3oxoe3, d3oxof2, d3oxof3, d3oxog2, d3oxog3, d3oxoh2, d3oxoh3
    automated match to d1ooyb2
    complexed with cl, coa

Details for d3oxof1

PDB Entry: 3oxo (more details), 2.3 Å

PDB Description: Succinyl-CoA:3-ketoacid CoA transferase from pig heart covalently bound to CoA
PDB Compounds: (F:) Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial

SCOPe Domain Sequences for d3oxof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oxof1 c.124.1.2 (F:1-246) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
erlsvr

SCOPe Domain Coordinates for d3oxof1:

Click to download the PDB-style file with coordinates for d3oxof1.
(The format of our PDB-style files is described here.)

Timeline for d3oxof1: