![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.3: CoA transferase beta subunit-like [74657] (4 proteins) catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest |
![]() | Protein automated matches [227046] (1 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [226017] (1 PDB entry) |
![]() | Domain d3oxod2: 3oxo D:262-478 [214586] Other proteins in same PDB: d3oxoa1, d3oxoa3, d3oxob1, d3oxob3, d3oxoc1, d3oxoc3, d3oxod1, d3oxod3, d3oxoe1, d3oxoe3, d3oxof1, d3oxof3, d3oxog1, d3oxog3, d3oxoh1, d3oxoh3 automated match to d1ooyb1 complexed with cl, coa |
PDB Entry: 3oxo (more details), 2.3 Å
SCOPe Domain Sequences for d3oxod2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oxod2 c.124.1.3 (D:262-478) automated matches {Pig (Sus scrofa) [TaxId: 9823]} vreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnevd adlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgklv kgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvdr kkgltlielwegltvddikkstgcdfavspklipmqq
Timeline for d3oxod2: