SCOPe 2.05: Domain d3oxoc2: 3oxo C:262-480

Lineage for d3oxoc2 (3oxo C:262-480)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.3: CoA transferase beta subunit-like [74657] (4 proteins)
   catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest

6. Protein automated matches [227046] (1 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [226017] (1 PDB entry)

8. Domain d3oxoc2: 3oxo C:262-480 [214584]
   Other proteins in same PDB: d3oxoa1, d3oxob1, d3oxoc1, d3oxod1, d3oxoe1, d3oxof1, d3oxog1, d3oxoh1
   automated match to d1ooyb1
   complexed with cl, coa

Details for d3oxoc2

PDB Entry: 3oxo, 2.3 Å

PDB Description: Succinyl-CoA:3-ketoacid CoA transferase from pig heart covalently bound to CoA

PDB Compounds: (C:) Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial

SCOPe Domain Sequences for d3oxoc2:

Sequence; same for both SEQRES and ATOM records:

>d3oxoc2 c.124.1.3 (C:262-480) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
vreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnevd
adlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgklv
kgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvdr
kkgltlielwegltvddikkstgcdfavspklipmqqle

Timeline for d3oxoc2:

• d3oxoc2 first appeared in SCOPe 2.03
  
• d3oxoc2 appears in SCOPe 2.04
  
• d3oxoc2 appears in SCOPe 2.06
  
• d3oxoc2 appears in the current release, SCOPe 2.08