Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 proteins) parallel beta-sheet of 7 strands, order 4321567 |
Protein automated matches [227045] (1 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [226016] (1 PDB entry) |
Domain d3oxob1: 3oxo B:1-247 [214581] Other proteins in same PDB: d3oxoa2, d3oxoa3, d3oxob2, d3oxob3, d3oxoc2, d3oxoc3, d3oxod2, d3oxod3, d3oxoe2, d3oxoe3, d3oxof2, d3oxof3, d3oxog2, d3oxog3, d3oxoh2, d3oxoh3 automated match to d1ooyb2 complexed with cl, coa |
PDB Entry: 3oxo (more details), 2.3 Å
SCOPe Domain Sequences for d3oxob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oxob1 c.124.1.2 (B:1-247) automated matches {Pig (Sus scrofa) [TaxId: 9823]} tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri erlsvrk
Timeline for d3oxob1: